Oz has been performing magic since she was 4 years old and flew out from New York with Popcorn Productions to put on a show at Fright Fest. Mikayla Oz’s Tricks and Treats Magic Show was one of the performances that drew a young crowd. “Nobody used to scare in this room,” Mungia said as she showed off her scare area in a small room of the manor.įright Fest is great if you love to be scared, but Discovery Kingdom is a family-friendly park so there is plenty of non-scary activities for the little monsters to experience earlier in the day before the spookies are unleashed. She wore a simple white nightgown as she knelt down in the corner and pretended to cry. Trails of blood ran down Mungia’s head as a mask, via COVID-19 protocol, obscured part of her face. Lizbeth Mungia, of Vallejo, haunts Nightmare Manor as she works during Fright Fest at Six Flags Discovery Kingdom. They have taken over the manor and have went a little crazy,” Mungia said. “I’m one of the little twins that killed their parents and all the staff in the house. Lizbeth Mungia from Vallejo is one of the monsters who is in her fifth year of haunting Nightmare Manor - one of six scare houses featured at the park. “Bring ’em out!” Vomit screamed as he unleashed all manner of creatures that go bump in the night during the second weekend of Fright Fest at Six Flags Discovery Kingdom in Vallejo. All it took was a little help from his friends. Normally Donny Vomit swallows swords in the Creepshow Freakshow, but on Friday Vomit became a magician as he made dozens of children disappear.
0 Comments
9/6/2023 0 Comments Snap ebt californiaA weekend (Saturday and Sunday) is considered one calendar day. Expedited CalFreshĮxpedited Services provide CalFresh benefits to potentially-eligible households (individuals, families, or groups of people that buy and prepare food together) by the 3rd calendar day following the application date. To be accepted, applications must contain each of these: your name, address, and signature.įor more information, please click the “How to Apply” Informational Flyer. Madera County Department of Social Services Once completed, the application can be mailed or faxed to: You can also request an application by calling 55. You may download an English or Spanish application from the California Department of Social Services website. To apply for benefits online, please visit. Eligible families do not need to apply to receive P-EBT extension benefits. These new P-EBT cards will be mailed directly to families in late October through late December.
9/6/2023 0 Comments Pixel qr code readerTap on a button to perform the said operation. QR & Barcode Scanner will scan the code and show you its content with a few action buttons below it. If the code is at a distance, use the magnifier at the bottom to zoom in and scan the code.Point your phone to the QR code, ensuring it fits in the square box on the screen. A week ago I update my pixel 5 to the new android 13 and after that I'm unable to use the new qr code scanner bottom on quick settings, the option is disabled and I don't know how to enable it.Open the image containing the QR code and hit the Share button. Make sure Show in Share Sheet is enabled. Touch and hold the QR Reader from the images shortcut and select the Details option in the menu. Launch the app and allow it access to your on-device media when prompted. Tap on the Add Shortcut button, then open the Shortcuts app to find the QR Reader from the images shortcut.Look for the camera icon either from the home screen or from the applications menu, it is usually a camera icon or a camera lens. Once installed, here's how to scan QR codes using QR & Barcode Scanner: 1- First step: To read QR codes on our Google Pixel 6 we will use the rear camera of the device and the pre-installed official application. Plus, as the name suggests, it can scan barcodes too, so you don't have to download dedicated barcode scanner apps for the same.īesides, the app also gives you a bunch of customization options to help you tweak or change its behavior with regard to scanning QR codes and displaying results.ĭownload: QR & Barcode Scanner (Free, in-app purchases available) It lets you scan QR codes in images, view the history of all your previous scans, share QR codes with others, and even create codes yourself. To use it, you need to add the tile to the Quick Settings panel. It's called QR code scanner, and you can access it from your device's Quick Settings menu. 1- First step: To read QR codes on our Google Pixel 5 we will use the rear camera of the device and the pre-installed official application. QR & Barcode Scanner is fast, reliable, and offers information-specific actions. Scan a QR Code on a Pixel With the Quick Settings Tile With Android 13, Google introduced a one-tap QR code scanner on all Pixel phones to make scanning QR codes easy. In this tutorial video, well show you how to scan QR codes using your Google Pixel 7a smartphone. 9/6/2023 0 Comments Tax freedom dayTax Freedom Day for each province varies according to the extent of the provincially and locally levied tax burden. “Canadians need to decide for themselves whether they are getting their money’s worth when it comes to how governments are spending their tax dollars.” Provincial Tax Freedom Days in 2023 “Tax Freedom Day helps put the total tax burden in perspective and helps Canadians understand just how much of their money they pay in taxes every year,” Fuss said. In 2023, the Balanced Budget Tax Freedom Day won’t arrive until June 27. To help illustrate this point, the study also calculates a Balanced Budget Tax Freedom Day-the day of the year when the average Canadian finally starts working for themselves if the governments paid for all of this year’s spending with taxes collected this year. The Concept of Balanced Budget Tax Freedom Day However, Canadians should also be concerned about the $47 billion in deficits the federal and provincial governments are forecasting this year, as these will have significant tax implications in future years. Thus, on June 19th-Tax Freedom Day-Canadians finally start working for themselves. Represented as days on the calendar, the total tax burden compromises more than five months of income-from January 1 to June 18. The Impact of Tax Burden on Calendar Days That’s 46.1% of its annual income ($140,106) going to income taxes, payroll taxes (including the Canada Pension Plan), health taxes, sales taxes (like the GST), property taxes, fuel taxes, carbon taxes, “sin” taxes, and more. In 2023, the average Canadian family (with two or more people) will pay $64,610 in total taxes. “If Canadians paid all their taxes upfront, they would work the first 169 days of this year before bringing any money home for themselves and their families,” said Jake Fuss, Associate Director of Fiscal Studies at the Fraser Institute. In other words, today is the day where every penny you earn goes straight. For those unfamiliar with the concept, Tax Freedom Day is defined as the day when average Britons stop working for the Chancellor and start working for themselves. Working for the Government Until Mid-June Today the Adam Smith Institute marks this year’s Tax Freedom Day. This year, the day has come eight days later than in 2019, the last year before the pandemic, and four days later than in 2021 when it fell on June 15. In 2007 Americans will work another 41 days to afford their state. Tax Freedom Day measures the total annual tax burden imposed on Canadian families by federal, provincial, and municipal governments. National Tax Freedom Day will fall April 30 this year two days later than the date in 2006. The Tax Foundation calculates Tax Freedom Day by adding together all federal. VANCOUVER – Politics – Canadians are celebrating “Tax Freedom Day”, a date in the year when they finally start working for themselves rather than for the government, according to a recent study published by the Fraser Institute, an independent, non-partisan Canadian public policy think-tank. In 2019, Tax Freedom Day fell on April 19, 105 days into the year and five days earlier than it was in 2017. Solve entertaining puzzles in order to progress on your quest. Continued abuse of our services will cause your IP address to be blocked indefinitely. Meet new MySims like King Roland and Princess Butter and reacquaint yourself with old friends like Ginny and Buddy. Please fill out the CAPTCHA below and then click the button to indicate that you agree to these terms. If you wish to be unblocked, you must agree that you will take immediate steps to rectify this issue. If you do not understand what is causing this behavior, please contact us here. If you promise to stop (by clicking the Agree button below), we'll unblock your connection for now, but we will immediately re-block it if we detect additional bad behavior. Overusing our search engine with a very large number of searches in a very short amount of time.Using a badly configured (or badly written) browser add-on for blocking content.Running a "scraper" or "downloader" program that either does not identify itself or uses fake headers to elude detection.Using a script or add-on that scans GameFAQs for box and screen images (such as an emulator front-end), while overloading our search engine.There is no official GameFAQs app, and we do not support nor have any contact with the makers of these unofficial apps. Continued use of these apps may cause your IP to be blocked indefinitely. This triggers our anti-spambot measures, which are designed to stop automated systems from flooding the site with traffic. Chocolate Cake is a Tasty essence found from prospecting in the Forest, near the waterfall and the gate that leads to the orchard where youll find Knight. Some unofficial phone apps appear to be using GameFAQs as a back-end, but they do not behave like a real web browser does.Using GameFAQs regularly with these browsers can cause temporary and even permanent IP blocks due to these additional requests. If you are using the Brave browser, or have installed the Ghostery add-on, these programs send extra traffic to our servers for every page on the site that you browse, then send that data back to a third party, essentially spying on your browsing habits.We strongly recommend you stop using this browser until this problem is corrected.
Politician and former Mayor of London Ken Livingstone talks about when he first met Doreen, his experience at the Greater London Council and the development of London as a global political economy. Michael Rustin, Professor of Sociology at the University of East London on the influence of Doreen's work on the relationship between economics and society The relationship between economics and society OU Professor Gillian Rose introduces the second panel and speaks on behalf of Stuart Hall, a retired OU Professor who worked with Doreen. Professor Gillian Rose speaks on behalf of Stuart Hall QUESTIONS 2014 Three Approaches in Defining the Space-Place Relationship Dana POP1 1 Technical University of Cluj-Napoca, Faculty of Architecture and Urban Planning 72-76 Observatorului Str., 400500, Cluj-Napoca, Romania (Accepted: 15 December 2014) Abstract Each person has a different perception of the reality surrounding them. Professor Jane Willis, Queen Mary University of London on London and the politics of placeĭoreen Massey reflects on the issues that the panellists have discussed LISTEN TO DOREEN MASSEY NOW Click HERE to download a PDF transcript of this conversation. In this episode of the Social Science Bites podcast she explains why. Professor Jamie Peck, University British Columbia talks about the influence of Doreen's work Geographer Doreen Massey wants us to rethink our assumptions about space. Professor Ash Amin from Durham University talks about the influence of Doreen's work Similar to Virilio, she states that because our world is 'speeding up' and 'spreading out'. Doreen Massey maintains this idea about time-space compression in her discussion of globalization and its effect on our society. OU Professor John Allen introduces the lecture Doreen Massey explains that time and space compressions is movement, interaction and experience across large spaces and shortening time while this happens (pg. Definition of timespace compression in the dictionary. Discover more from The Open University and iTunesU at /itunesĭoreen talks about her life and work at The Open University.Theorists generally identify two historical periods in which time. Discover more from The Open University and iTunesU at /itunes. Download this track from iTunes - youll need Apples free iTunes software. Read a transcript of this track - youll need a PDF viewer, such as Adobes free Adobe Reader. Download this track from iTunes - you'll need Apple's free iTunes software In his view, acceleration destroys space and compresses time in ways of perceiving reality. Doreen talks about her life and work at The Open University. She was one of the most influential thinkers on the left, and her work on space, place and power has been recognized all over the world. Read a transcript of this track - you'll need a PDF viewer, such as Adobe's free Adobe Reader Doreen Massey, emeritus professor of geography at The Open University, and one of the major figures in twentieth-century geography, passed away suddenly on March 11, 2016, at the age of 72. 9/6/2023 0 Comments Dictionaries pythonformat ( aaCode, aaCount )) 8.3 A practical example of dictionariesĪn practical example of dictionaries can be found in Biopython. MySequence = "SFTMHGTPVVNQVKVLTESNRISHHKILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADT" myDictionary = times.". The keys in a dictionary must be immutable objects like strings or numbers. Python dictionaries are called associative arrays or hash tables in other languages. It is mutable and can contain mixed types. Once you feel comfortable with these concepts, test yourself in Lesson 07: Coding Exercise.# Another way to do this, a little bit more elaborate and using the myDictionary as a reference for iteration Python dictionary is a container of key-value pairs. In other words, we have changed it in memory. This is because dictionaries are mutable. If we were to reprint off a_dict, we’d see that it now has a new value. To change the value of “birth_year” to 1990, we simply write: Sometimes you will need to update and change the data in your dictionary. If we run this, it would return a value of 1988. Let’s say, we wanted to get the year that corresponds to a_dict’s “birth_year” key. As with lists and tuples, we need to index the dictionary. A dictionary is also a Python object which stores the data in the key:value format. We need to understand how to call specific keys and their corresponding values. In the example above, the key “birth_year” now has two values: 19.īut we need to do more than simply create dictionaries. Like lists and tuples, you can embed data structures within a Python dictionary.Įxample of a list inside of a dictionary: The dictionary name could be the name of the individual to whom the row corresponds. In digital humanities projects, dictionaries are particularly useful for structuring complex data that you may have in Excel with each key being an Excel column and each value being its corresponding value. list.insert(i, x) Insert an item at a given position. list.extend(iterable) Extend the list by appending all the items from the iterable. Setis a collection which is unordered, unchangeable, and unindexed. Here are all of the methods of list objects: list.append(x) Add an item to the end of the list. Tupleis a collection which is ordered and unchangeable. Listis a collection which is ordered and changeable. In the example below, we have a dictionary, a_dict, with a key of “birth_year” and a value of 1988. There are four collection data types in the Python programming language: 1. All of this is contained within squiggly brackets. These two components are separated by a colon. There are ways to make a copy, one way is to use the built-in Dictionary method copy (). Instead, they have two components: keys and values. You cannot copy a dictionary simply by typing dict2 dict1, because: dict2 will only be a reference to dict1, and changes made in dict1 will automatically also be made in dict2. Unlike tuples and lists, dictionaries are not lists of data. The dictionary contains a unique key value as an index and each key represents a particular value. They map keys, which can be any immutable type, to values, which can be any type, just like the values of a list or. Dictionaries are a compound type different from the sequence types we studied in the Strings, lists, and tuples chapter. Like lists, dictionaries are mutable, meaning they can be changed in memory. Dictionaries are used in Python to store key value pairs. Dictionaries, sets, files, and modules ¶. Like tuples and lists, dictionaries are a data structure in Python. Let’s start our step by step installation guide. We are going to use Bluestacks in this method to Download and Install iNet Pro - Network Scanner for PC Windows 11/10/8/7 Laptop. Bluestacks software is even available for Mac OS as well. Method 2: iNet Pro - Network Scanner for PC Windows 11/10/8/7 or Mac using BlueStacksīluestacks is one of the coolest and widely used Emulator to run Android applications on your Windows PC. As it is designed for Gaming purposes, you can play high-end games like PUBG, Mini Militia, Temple Run, etc. It is very lightweight compared to Bluestacks. NoxPlayer is simple and easy to use application. Step 4: Upon successful installation, you can find iNet Pro - Network Scanner on the home screen of NoxPlayer.Find the official from developer and click on the Install button. Step 3: Now search for iNet Pro - Network Scanner on Google playstore.Step 2: Once the emulator is installed, just open it and find Google Playstore icon on the home screen of NoxPlayer.Open the official website and download the software. Here is the Download link for you – NoxPlayer Website. Step 1: Download and Install NoxPlayer on your PC.Now we will see how to Download iNet Pro - Network Scanner for PC Windows 11 or 10 or 8 or 7 laptop using NoxPlayer. It is super flexible, fast and exclusively designed for gaming purposes. NoxPlayer is Android emulator which is gaining a lot of attention in recent times. Method 1: iNet Pro - Network Scanner Download for PC Windows 11/10/8/7 using NoxPlayer Here we will show you how to install and use the two emulators above to run Android and iOS applications on Windows and MAC computers. iNet is also available for iPhone and for iPad.Currently, the demand for using applications for Android and iOS on computers is great, so there have been many emulators born to help users run those applications on their computers, outstanding above all Bluestacks and NoxPlayer. We will add modules in the future like traceroute and more. Minimal system required for WOL: OS X 10.7.Put devices remotely to sleep, shutdown or restart (Macintosh only).Wake devices remotely in your local network or via internet.See the connection quality of the connected wifi clients in realtime.Find detailed information about your Airport base stations like MAC address, IP's, used channels and so on.Monitor network traffic on Airport devices.See the current condition of Apple Airport base stations like Airport express or Time Capsule.The following Airport monitoring features can only be used with models prior to the 802.11ac: All other features of iNet are working properly. Attention for users of the latest 2013 Airport edition with 802.11ac: Because SNMP support has been disabled by Apple iNet cannot retrieve the usage statistics and wifi strength any more with these models.Choose the active Bonjour domain for observing.Detect running services on a discrete device.Detect all running Bonjour services realtime.Connect to devices via different protocols.Most Mac devices are displayed with their original icon. Assign your own names and icons or choose from the provided icons for easier identifying a device in the scan list.See all devices that are online and connected to a network, along with vendor, IP and MAC addresses.Wether you are a network expert or a common user - iNet provides the information you need to find out what's going on in your network. We did our best to develop a solution that makes network observing as simple as possible. In the current version the following functions are available: Its very easy and user friendly design even allows the unexperienced user to get a profound and understandable overview of a network, the running services and the Wi-Fi quality. INet provides you with information about networks and devices your Mac is connected to. Is somebody using your network without your knowledge? Which devices are currently online? Which access ports are open? Which services are offered? What is the IP of your router? Wake sleeping devices remotely. This easy to use App outlines a computer network even to the unexperienced user. Developed and refined since 2009.įind out about security risks and keep your network under control. INet - One of the best network scanner for Mac and iOS devices. 9/6/2023 0 Comments No doubt sparkle meaningHer life trials dance in her voice in His Eye is on the Sparrow. Houston embodies Emma, and plays her with a cool, yet fierce sophisticated determination. The sparkle, nonetheless, shines on Whitney Houston, Carmen Ejogo, and Tika Sumpter. “I want to be bigger than Diana Ross,” reveals Sparkle to Stix under the stars. The Akils, however, gently manipulate Motown’s reputation to fuel the mother/daughter conflict and the quest for the dream. He brazenly flaunts his material success in front of Levi as Levi expresses his desire for Sister later, however, he reveals his insecurity over his new material.Įxpectedly, references to Motown and its talent line-up abound, yet do not overwhelm the story. Epps, in turn, gives a marvelous performance as the successful stand-up comedian whose jokes are contemptuous of African Americans. Hardwick, especially, translates with splendid bravura Levi’s torment when he discovers that his words cannot compete with the conspicuous bling of the wealthy, but mean-spirited Satin (Mike Epps). Stix (Derek Luke) and Levi (Omari Hardwick) shines as wordsmiths coaxing the young women to consider them worthy suitors/partners. On another note, the Akils skillfully dramatize the forgotten art of courtship, and the duo’s brilliant virtuosity of storytelling glistens here. Like the butterflies and the birds, the women in this household are trapped yet, as does Dunbar’s caged bird, each dares to break free from pasts that have held them and Emma hostage. Emma’s daughters are coming of age, and the painful transition causes domestic seismic shifts that disquiet Emma but feed her daughters’ yearnings. On the whole, Sparkle is a graceful exploration of generational anxiety aggravated by socio-cultural changes. These set props give nod to Paul Laurence Dunbar’s poem “Sympathy”, whose first lines inspired the title of Maya Angelou’s book, I Know Why the Caged Bird Sings. The wall art of encased butterflies and birds, however, betray this charm. Even the bedtime wardrobes are luxuriant: sheer nylon peignoirs accentuated with ruffles and bows, and quilted satin bathrobes in colors of aqua, champagne and pink. For church, gloves, hats, and coat dresses trimmed in fur and for daytime, suits and sheaths. Craig Anthony’s spectacular costumes showcase each lady in her sartorial splendor. Michos, highlights the trappings of her success: a two-story with a staircase the Queen Anne and Bergère chairs the small library with piano crystal chandeliers and the sugar and spice bedrooms replete with iron beds, vanities, and full length mirrors emphasized by pink and white flowered wallpaper. The cinematic presence of the Black church denotes her anchor, and this institution no doubt facilitated the upbringing of her daughters and made possible the acquisition and preservation of her middle class existence.Įmma’s home, beautifully shot by cinematographer Anastas N. Her rule is “respect, education and loving the Lord”. Emma’s story is that of 1960s upward mobility despite setbacks she endured in her youth–the harshest being her teen-age pregnancy. Rather than inundate the audience with a multitude of song and dance routines, the film focuses on the story of a single African American mother, Emma (Whitney Houston) who successfully has raised three attractive, well-adjusted, and talented daughters, Tamy/Sister (Carmen Ejogo), Dolores “Dee”, (Tika Sumpter), and Sparkle (Jordin Sparks) in the bustling city of Detroit, Michigan. This socio-cultural context signals that Akil Production Company and Chase have crafted a film that expands the 1976 story but stands on its own. As his soulful “I am a Man” opens the action, placards held by Memphis Sanitation workers in 1968 captured by African American photographer Ernest C. The camera swoops into Discovery, a juke-joint whose ambience of smoky rhythm, saucy blues, and salty sweat, is thickened by R&B crooner, Black (Cee-Lo Green). The film opens in 1968 to a cacophony of voices broadcasting newsworthy events: The Vietnam War, The Beatles, civil rights and Martin Luther King, Jr. Akil Production Company, along with two-time Emmy nominee Debra Martin Chase ( The Princess Diaries Just Wright), pay a respectful homage to its 1976 predecessor. Sparkle is a lush cinematic cultural artifact sustained by a sumptuous set, a dynamic soundtrack, and the rigorous artistry of its cast. We’ll walk you through the decisions involved, including picking out a pattern and deciding on the application (inside, outside, in between the glass). They can really complete the look of a home. The best way to confirm if the inserts will fit is by measuring your frames and compare the sizes in the chart above. Grilles are the ornamental bars applied to window glass that create a pattern. The label in the picture below will be located on the side of your garage door.Īctual Insert Dimensions - Note that the inserts fit between the outside frame and glass and this will hide the edge of the insert. Refer to the picture and color code chart below to determine what color inserts to purchase. Available door widths are listed under each sunset design. Sunset designs shown below are for specific door widths with a specific number of windows. No sunset designs are available for larger frames. Plus, we also offer a vinyl grille option for low. Our wood inserts for windows come in a variety of styles, making them the perfect solution for any standard profile window. We are the go-to source for standard profile wood grilles that enhance views from inside and out. (Not the measurement of the inserts themselves) See your home in a brand-new way with custom window grilles by Fixhome. The glass is the same size and not included.ĭimensions listed below are the window frame outside to outside edge measurements. The front and back frames are included in the price of designs labeled for prior to May 2018. Acoustic-grade window inserts are meant to dampen noise by as much as 70. Refer to the charts below to determine the window size, insert types and matching color for your garage door.Īrchitectual windows made before May 2018 require a new frame. Results Price and other details may vary based on product size and color. High-quality window inserts are designed to reduce noise by at least 50. These inserts will fit Holmes and Ideal garage door windows too. Add stylish room separation with tableaux decorative grilles, available in a variety of colors and finishes, and in an array of patterns - from intricate and ornate to. Clopay has several different sizes and types of windows. This tableaux decorative grille adds an artisan-inspired designer’s touch to this kitchen by creating an elegant wrought iron appearance, yet it’s also extremely affordable. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |